PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0019600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 655aa    MW: 71524.9 Da    PI: 4.3876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0019600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-153178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  l d+v+++G g+W+++ +  g+ R++k+c++rw ++l
   Spipo3G0019600 31 KGPWTAAEDAVLRDYVAKHGEGNWNAVQKQTGLLRCGKSCRLRWANHL 78
                     79******************************99**********9986 PP

2Myb_DNA-binding40.94.8e-1384127146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+   ++++   G++ W++ a ++  gRt++++k++w++
   Spipo3G0019600  84 KGPFTPEEEATVIKLHYTEGNK-WAKMATHLE-GRTDNEIKNYWNT 127
                      79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.0542682IPR017930Myb domain
SuperFamilySSF466892.19E-2829125IPR009057Homeodomain-like
SMARTSM007173.1E-133080IPR001005SANT/Myb domain
PfamPF002493.4E-143178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-233285IPR009057Homeodomain-like
CDDcd001672.67E-103378No hitNo description
PROSITE profilePS5129416.05883133IPR017930Myb domain
SMARTSM007171.1E-1283131IPR001005SANT/Myb domain
PfamPF002494.1E-1284127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2286131IPR009057Homeodomain-like
CDDcd001676.05E-986127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MPQNDGAESP TADEGSSDAS AQGEGGGALK KGPWTAAEDA VLRDYVAKHG EGNWNAVQKQ  60
TGLLRCGKSC RLRWANHLRP NLRKGPFTPE EEATVIKLHY TEGNKWAKMA THLEGRTDNE  120
IKNYWNTRMK RCQRTNTPIY PPHLVDQLPS GRPNGENGDQ TQAGGRQQQE GVKSTGLNIP  180
PVDFDFKPRV VLPQLAYSGV KIRRILSESL GLQSFSSSPL PPLDHPMPFL PSETSIDHWL  240
DFPLDIDIPY APEPPGCNFP ASQPPPQAMN PTSHQFVSSQ RVDFPQGIYI LLXXXXXXXP  300
GRNFSASQFP PEAMNPTSDQ FFSPQMVDFP QGIYILPEPD PPGRNFPASQ PPPEAMNPTS  360
GQFVSSQRSD FPQAVGILAD PEPPERSILA SQVPPEAMRP TSDQFVSSQR SDFPLAVDIP  420
YDPEPPDRNF AASQFPPVAM SPELPSLQDE VIDFGGSPHF PPLRPPEEME KCVECPLGAQ  480
VQIRSDRIYS SCNNGLLGSV VDEAQAMASA KEKSAEKISE APAAIADASF QRPSEDDPRL  540
AGCASLDDPD MEMSYLSALP SDLHTPPTGG SSLDHPSAAN ASADFDAIMS DIIAGTDISP  600
KPDSLTAFNP FNGDIRKQLF YELPQSSEMN QELDVFDFSN LPWDHSDVPM PDLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25291315106B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-61myb domain protein 33